Protein coding transcript 95959

• Transcript: Ll_transcript_515772
• CDS coordinates: 211-507 (+)
• Peptide sequence: MSRYTVGKITPIQRREVRASDFGPRASFWMNFPKDGSQLTPPHQSEDFKWKDYCPMVFRNLRELFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_515772

• Blastp: Phosphatidylinositol 4-phosphate 5-kinase 9 from Arabidopsis with 88.66% of identity
• Blastx: Phosphatidylinositol 4-phosphate 5-kinase 9 from Arabidopsis with 73.81% of identity
• Eggnog: whole genome shotgun sequence(COG4642)
• Kegg: Link to kegg annotations (AT3G09920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020234335.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;