Protein coding transcript 95963

• Transcript: Ll_transcript_516365
• CDS coordinates: 273-1721 (+)
• Peptide sequence: MEAEKSNVSKAEELKLLANEAFSARKYSQAIDLYTQAIELRSQNAVYWANRAFAHIRLEEYGSAIEDATEAIEVDPKYSKGYYRRGAAHLGLGKFKEALKDFQQVKKMCPNDPDATKKLKECEKAVMKLKFEEAIAAPEAERHSIAESIDYKSIDVESQYSGARIEGDIITLDFVKKMMDDFKNQKCLHTRYAYQIVLQTRERLQALPSLVDINVPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSLEVILTLFAFKCMSPSAIYLARGNHESKSMNKIYGFEGEVRSKLNDSFVELFAEVFCSLPLAHVINQKVFVVHGGLFSVDGVKLSDIRAINRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQENNLDLVVRSHEVKDEGYEVDHDGKLITVFSAPNYCDQMGNKGAFIRFEAPDLKPNIITFSAVPHPDVKPMAYANNFLRMFS*
• ORF Type: complete

Annotations of Ll_transcript_516365

• Blastp: Serine/threonine-protein phosphatase 5 from Arabidopsis with 75.98% of identity
• Blastx: Serine/threonine-protein phosphatase 5 from Arabidopsis with 75.98% of identity
• Eggnog: serine threonine-protein phosphatase(COG0639)
• Kegg: Link to kegg annotations (AT2G42810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426309.1)
• Pfam: Tetratricopeptide repeat (PF13432.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;