Transcript | Ll_transcript_516372 |
---|---|
CDS coordinates | 325-759 (+) |
Peptide sequence | MEAEKSNVSKAEELKLLANEAFSARKYSQAIDLYTQAIELRSQNAVYWANRAFAHIRLEEYGSAIEDATEAIEVDPKYSKGYYRRGAAHLGLGKFKEALKDFQQFSLSGSSLWHSANRSCLVNSLPHIYCSVTCTFAHMQALLI* |
ORF Type | complete |
Blastp | Serine/threonine-protein phosphatase 5 from Lycopersicon with 78.85% of identity |
---|---|
Blastx | Serine/threonine-protein phosphatase 5 from Lycopersicon with 60.47% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (543849) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426308.1) |
Pfam | Tetratricopeptide repeat (PF13432.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer