Protein coding transcript 95970

• Transcript: Ll_transcript_516354
• CDS coordinates: 1038-2267 (+)
• Peptide sequence: METNHSKAEEFKLLANEAFGARKYAQAIELYTKAIELNSQNAVYLANRAFAHLRREEYGSAIQDATKAIEVDPKYSKGYYRRGTAHLAMGKFKEALKDFQQVKKLCPNDPDATKKLKECEKAVMKLKFEEAIAVPESLRHSVAESIDFHTIDVEPQYSGARIEGDVVTLDFVKKMMDDFKNQKFLHKRYAFQIVLQTRDILRALPSLVDINVPNGKHFTVCGDVHGQYYDLVNIFELNGLPSEDNPYLFNGDFVDRGSFSLEVILTLFALKCMSPSALYLARGNHESKNMNKIYGFEGEVRSKLNETFVELFAEVFCCLPLAHVINEKVFVVHGGLFSVDGVKLSDIRAIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQENNLDLVVRSHEV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_516354

• Blastp: Serine/threonine-protein phosphatase 5 from Lycopersicon with 91.92% of identity
• Blastx: Serine/threonine-protein phosphatase 5 from Lycopersicon with 91.92% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (543849)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456718.1)
• Pfam: Tetratricopeptide repeat (PF13181.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;