Protein coding transcript 95971

• Transcript: Ll_transcript_516374
• CDS coordinates: 111-1076 (+)
• Peptide sequence: MATENSNVSKAEEFKLLANKAFGARKYAQAIELYTKAIELNSQNAVYLANRAFAHLRREEYGSAIQDATEAIEVDPKYSKGYYRRGTAHLAMGKFKEALKDFQQVKKLCPNDPDATKKLKECEKAVMKLKFEEAIAVPESLRHSVAESIDFHTIDVEPQYSGARIEGDVVTLDFVKKMMDDFKNQKFLHKRYAFQIVLQTRDILRALPSLVDINVPNGKHFTVCGDVHGQYYDLVNIFELNGLPSEDNPYLFNGDFVDRGSFSLEVILTLFALKCMSPSALYLARGNHESKNMNKIYGFEGEVRSKLNETFVELFAEVFCCL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_516374

• Blastp: Serine/threonine-protein phosphatase 5 from Mus with 53.02% of identity
• Blastx: Serine/threonine-protein phosphatase 5 from Arabidopsis with 65.95% of identity
• Eggnog: serine threonine-protein phosphatase(COG0639)
• Kegg: Link to kegg annotations (19060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456720.1)
• Pfam: Tetratricopeptide repeat (PF13432.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;