Protein coding transcript 95972

• Transcript: Ll_transcript_516375
• CDS coordinates: 117-962 (+)
• Peptide sequence: METNHSKAEEFKLLANEAFGARKYAQAIELYTKAIELNSQNAVYLANRAFAHLRREEYGSAIQDATKAIEVDPKYSKGYYRRGTAHLAMGKFKEALKDFQQVKKLCPNDPDATKKLKECEKAVMKLKFEEAIAVPESLRHSVAESIDFHTIDVEPQYSGARIEGDVVTLDFVKNMMGDFKNQKFLHKRYAFQIVLQTREILRALPSLVDINVPTGKLFTVCGDVHGQYYDLLNIFELNGLPSEDNPYLFNGDFVDRGSFSLEVILTLFAFKCMSPSAIYLAR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_516375

• Blastp: Serine/threonine-protein phosphatase 5 from Rattus with 53.02% of identity
• Blastx: Serine/threonine-protein phosphatase 5 from Arabidopsis with 65.58% of identity
• Eggnog: serine threonine-protein phosphatase(COG0639)
• Kegg: Link to kegg annotations (65179)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461786.1)
• Pfam: Tetratricopeptide repeat (PF13181.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;