Protein coding transcript 95978

• Transcript: Ll_transcript_516358
• CDS coordinates: 273-950 (+)
• Peptide sequence: MEAEKSNVSKAEELKLLANEAFSARKYSQAIDLYTQAIELRSQNAVYWANRAFAHIRLEEYGSAIEDATEAIEVDPKYSKGYYRRGAAHLGLGKFKEALKDFQQVKKMCPNDPDATKKLKECEKAVMKLKFEEAIAAPEAERHSIAESIDYKSIGKSRNSSVPTKMAIAAVTVAVMAVVVMLFRSSMTIIVAAIVVGLLLLLGAFRWSGHNTGIFRSRLHDQVLA*
• ORF Type: complete

Annotations of Ll_transcript_516358

• Blastp: Serine/threonine-protein phosphatase 5 from Lycopersicon with 73.08% of identity
• Blastx: Serine/threonine-protein phosphatase 5 from Lycopersicon with 77.38% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (543849)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426308.1)
• Pfam: Tetratricopeptide repeat (PF13432.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;