Protein coding transcript 95990

• Transcript: Ll_transcript_516274
• CDS coordinates: 810-1160 (+)
• Peptide sequence: MFCLYLYPENGQDRKVFRKDVVFVVDISASMKGIPLENIKHAVLASLSQLSAQDTFNLIAFNVEVNLWSPCMEPATEEAILKATKWVDTTFIANGGTNIMLPLTKRDMQFCEKLCH*
• ORF Type: complete

Annotations of Ll_transcript_516274

• Blastp: Inter alpha-trypsin inhibitor, heavy chain 4 from Mus with 39.8% of identity
• Blastx: Inter alpha-trypsin inhibitor, heavy chain 4 from Mus with 34.62% of identity
• Eggnog: von Willebrand factor, type A(COG2304)
• Kegg: Link to kegg annotations (16427)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461918.1)
• Pfam: von Willebrand factor type A domain (PF13768.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;