Protein coding transcript 95996

• Transcript: Ll_transcript_516297
• CDS coordinates: 1448-2320 (+)
• Peptide sequence: MKGIPLENIKHAVLASLSQLSAQDTFNLIAFNVEVNLWSPCMEPATEEAILKATKWVDTTFIANGGTNIMLPLTKAMKLFQKSTNSISLIFLVTDGAVDDEREICNFVKNCVTSLQSIRTPRVCTFGIGLYCNHYFLQMLAQIGRGHYDAAHDLDSIDFRMQRLFNTASSVIVADITIESLEDLELQLFPNHIPDLSLGSLFIISGRCDGTFPESVKVTGTLADMTNFVMELKVKREKDMKLSNILSKRHIDLVTADAWLLENEELKEKVCIQHTFLVFIFEKETIEEKI*
• ORF Type: complete

Annotations of Ll_transcript_516297

• Blastp: Inter-alpha-trypsin inhibitor heavy chain H4 from Homo with 27.23% of identity
• Blastx: Inter-alpha-trypsin inhibitor heavy chain H4 from Homo with 27.73% of identity
• Eggnog: von Willebrand factor, type A(COG2304)
• Kegg: Link to kegg annotations (3700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461918.1)
• Pfam: von Willebrand factor type A domain (PF13768.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;