Protein coding transcript 96000

• Transcript: Ll_transcript_516306
• CDS coordinates: 1751-2623 (+)
• Peptide sequence: MKGIPLENIKHAVLASLSQLSAQDTFNLIAFNVEVNLWSPCMEPATEEAILKATKWVDTTFIANGGTNIMLPLTKAMKLFQKSTNSISLIFLVTDGAVDDEREICNFVKNCVTSLQSIRTPRVCTFGIGLYCNHYFLQMLAQIGRGHYDAAHDLDSIDFRMQRLFNTASSVIVADITIESLEDLELQLFPNHIPDLSLGSLFIISGRCDGTFPESVKVTGTLADMTNFVMELKVKREKDMKLSNILSKRHIDLVTADAWLLENEELKEKVCIQHTFLVFIFEKETIEEKI*
• ORF Type: complete

Annotations of Ll_transcript_516306

• Blastp: Inter-alpha-trypsin inhibitor heavy chain H4 from Homo with 27.23% of identity
• Blastx: Inter-alpha-trypsin inhibitor heavy chain H4 from Homo with 27.73% of identity
• Eggnog: von Willebrand factor, type A(COG2304)
• Kegg: Link to kegg annotations (3700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456456.1)
• Pfam: von Willebrand factor type A domain (PF13768.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;