Protein coding transcript 96009

• Transcript: Ll_transcript_516286
• CDS coordinates: 1012-1404 (+)
• Peptide sequence: MFCLYLYPENGQDRKVFRKDVVFVVDISASMKGIPLENIKHAVLASLSQLSAQDTFNLIAFNVEVNLWSPCMEPATEEAILKATKWVDTTFIANGGTNIMLPLTKAMKLFQKSTNSISLIFFFFDGAVDDE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_516286

• Blastp: Inter alpha-trypsin inhibitor, heavy chain 4 from Mus with 36.36% of identity
• Blastx: Inter alpha-trypsin inhibitor, heavy chain 4 from Mus with 36.79% of identity
• Eggnog: von Willebrand factor, type A(COG2304)
• Kegg: Link to kegg annotations (16427)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461918.1)
• Pfam: von Willebrand factor type A domain (PF13768.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;