Protein coding transcript 96230

• Transcript: Ll_transcript_516788
• CDS coordinates: 263-790 (+)
• Peptide sequence: MLIFNLNADSNENGDLLELLEKIPEASSGTSNSSIVNADGSSNIGGGDDSCCTRAGNGSGVFTFDFGIMKVEGRNEVVTPTKELFPMSSGNWKMQQQSTVSFPARKGGVDLLWEQGENSEMVKMVQTQKPVKKSRRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGKSLR*
• ORF Type: complete

Annotations of Ll_transcript_516788

• Blastp: AP2-like ethylene-responsive transcription factor TOE2 from Arabidopsis with 43.22% of identity
• Blastx: Floral homeotic protein APETALA 2 from Arabidopsis with 73.03% of identity
• Eggnog: AP2(ENOG4110426)
• Kegg: Link to kegg annotations (AT5G60120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444681.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;