Protein coding transcript 9640

• Transcript: Ll_transcript_358241
• CDS coordinates: 895-1314 (+)
• Peptide sequence: MYFNYVCACSFSVDDFPIRVFKNNEDKGVPYPMMQPMGIYSTLWEADNWATRGGLEKINWNKAPFYAYYKDFDIEGCAVPGAANCSSNLSNWWEGPTYQALNAIQNRRYKWVRLNHLIYDYCQDKSRFLVTPPECLAGI*
• ORF Type: complete

Annotations of Ll_transcript_358241

• Blastp: Probable xyloglucan endotransglucosylase/hydrolase protein 7 from Arabidopsis with 69.77% of identity
• Blastx: Probable xyloglucan endotransglucosylase/hydrolase protein 7 from Arabidopsis with 69.77% of identity
• Eggnog: hydrolase family 16(COG2273)
• Kegg: Link to kegg annotations (AT4G37800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444955.1)
• Pfam: Glycosyl hydrolases family 16 (PF00722.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;