Transcript | Ll_transcript_515047 |
---|---|
CDS coordinates | 141-965 (+) |
Peptide sequence | MVADSNSKSDISFAGLFASSAFSACFAEVTTIPLDTAKVRLQLQKKAVAGDVVTLPKYKGLVGTVGTIAREEGISALWRGIVPGLHRQCLYGGLRIGLYEPVKSLYVGKDHVGDVSLSKKILAAFTTGAVAIMVANPTDLVKVRLQTEGKLPPGVPRRYSGSLNAYSTIVRQEGVGALWTGLGPNIARNGIINAAELASYDQVKQTILKIPGFKDNVVTHLLSGLGAGFFAVCIGSPIDVVYFQNFCINFNSCFDFFITSFFFNMHRVHNWLTI* |
ORF Type | complete |
Blastp | Mitochondrial uncoupling protein 1 from Arabidopsis with 82.48% of identity |
---|---|
Blastx | Mitochondrial uncoupling protein 1 from Arabidopsis with 82.48% of identity |
Eggnog | UnCoupling Protein(ENOG410XRV1) |
Kegg | Link to kegg annotations (AT3G54110) |
CantataDB | Link to cantataDB annotations (CNT0001420) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432004.1) |
Pfam | Mitochondrial carrier protein (PF00153.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer