Protein coding transcript 96409

• Transcript: Ll_transcript_515075
• CDS coordinates: 201-539 (+)
• Peptide sequence: MVGGGNSNSDISFAGTFAASAFSACFAEICTIPLDTAKVRLQLQKQAVGDAVIPKYKGMLGTVGTIAREEGLAALWKGIVPGLHRQCLYGGLRIGLYEPVSSVLCHKKMAIY*
• ORF Type: complete

Annotations of Ll_transcript_515075

• Blastp: Mitochondrial uncoupling protein 1 from Arabidopsis with 69.44% of identity
• Blastx: Mitochondrial uncoupling protein 1 from Arabidopsis with 83.73% of identity
• Eggnog: UnCoupling Protein(ENOG410XRV1)
• Kegg: Link to kegg annotations (AT3G54110)
• CantataDB: Link to cantataDB annotations (CNT0001420)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450446.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;