Protein coding transcript 9641

• Transcript: Ll_transcript_358243
• CDS coordinates: 208-1071 (+)
• Peptide sequence: MATFGVLIILSLWVLVSAICAWGRPATFVQDFRSTWSESHIKQIDQGRAIQLILDQNSGCGFASRRKYMFGRVSMKIKLIPGDSAGTVTAFYLNSDTDTIHDELDFEFLGNRSGQPYTVQTNIYAHGKGGREQRVNLWFDPALDYHNYTILWNHRHIVFSVDDFPIRVFKNNEDKGVPYPMMQPMGIYSTLWEADNWATRGGLEKINWNKAPFYAYYKDFDIEGCAVPGAANCSSNLSNWWEGPTYQALNAIQNRRYKWVRLNHLIYDYCQDKSRFLVTPPECLAGI*
• ORF Type: complete

Annotations of Ll_transcript_358243

• Blastp: Probable xyloglucan endotransglucosylase/hydrolase protein 6 from Arabidopsis with 73.48% of identity
• Blastx: Probable xyloglucan endotransglucosylase/hydrolase protein 6 from Arabidopsis with 76.05% of identity
• Eggnog: hydrolase family 16(COG2273)
• Kegg: Link to kegg annotations (AT5G65730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444955.1)
• Pfam: Glycosyl hydrolases family 16 (PF00722.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;