Protein coding transcript 96426

• Transcript: Ll_transcript_515330
• CDS coordinates: 297-938 (+)
• Peptide sequence: MAMSCKDGTKNGMDNGKYVRYTPEQVEALERLYHDCPKPTSIRRQQLIRDCPILSNIEPKQLKVWFQNRRCREKQRKEASRLQTVNRKLTAMNKLLMEENDRLQKQVSHLVYENGYFRQHTQNTTLATKDTSCESAVTSGQHSLTTKHPPRDASPAGLLSIAEETLAEFLSKATGTAVEWVQMPGMKPGPDSIGIVAISHGCTGVAARACGLVG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_515330

• Blastp: Homeobox-leucine zipper protein ATHB-15 from Arabidopsis with 88.32% of identity
• Blastx: Homeobox-leucine zipper protein ATHB-15 from Arabidopsis with 88.32% of identity
• Eggnog: homeobox-leucine zipper protein(ENOG410XQ3R)
• Kegg: Link to kegg annotations (AT1G52150)
• CantataDB: -
• Mirbase: cln-MIR166 (MI0022568)
• Ncbi protein: Link to NCBI protein (XP_019429328.1)
• Pfam: Homeobox domain (PF00046.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;