Protein coding transcript 96439

• Transcript: Ll_transcript_515333
• CDS coordinates: 2-505 (+)
• Peptide sequence: HLKLISLFLLLLLFILNLYRNFPNVLSSGTLCRFYLAVELLKCDDNESILKSLWHHSDAILCCSLKALPVFTFANQARLDMLETTLVAIQDITLEKIFDNNGKKRLCSEFPHIMQQGFICIEGGICLSSMERPVSYERAVAWKVLNEEETAIAYVSCLLIGLLFDKI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_515333

• Blastp: Homeobox-leucine zipper protein ATHB-15 from Arabidopsis with 80.99% of identity
• Blastx: Homeobox-leucine zipper protein ATHB-15 from Arabidopsis with 80.99% of identity
• Eggnog: homeobox-leucine zipper protein(ENOG410XQ3R)
• Kegg: Link to kegg annotations (AT1G52150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417530.1)
• Pfam: MEKHLA domain (PF08670.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;