Protein coding transcript 96475

• Transcript: Ll_transcript_389191
• CDS coordinates: 543-842 (+)
• Peptide sequence: MDLVDFLVTSMFDLMENNKEVALLYITMLKECLHGSQVATMHVLGSQQYMRTFLDYVTLPNYTFAAHVARMIELLLTMYTSTVTDFLTRNYEWFFDDFL*
• ORF Type: complete

Annotations of Ll_transcript_389191

• Blastp: Putative MO25-like protein At4g17270 from Arabidopsis with 39.8% of identity
• Blastx: Putative MO25-like protein At5g47540 from Arabidopsis with 38.78% of identity
• Eggnog: Calcium binding protein(ENOG410XP4S)
• Kegg: Link to kegg annotations (AT4G17270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003610565.2)
• Pfam: Mo25-like (PF08569.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;