Protein coding transcript 966

• Transcript: Ll_transcript_503255
• CDS coordinates: 2-424 (+)
• Peptide sequence: VCVFEALAKAPSAATPHALRWYNHIKSFQGAEKTKLPGKKEVPAALLKGGSAAAPAAAAKPAAKPAADDDDDVDLFGSDEEEDAEAAKIREERLAAYAATRSTKPTLIAKSSNVMDVKPWDDETDMAALEAAVRSVEKPGL
• ORF Type: internal

Annotations of Ll_transcript_503255

• Blastp: Elongation factor 1-beta from Xenopus with 54.23% of identity
• Blastx: Elongation factor 1-beta from Xenopus with 54.23% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (399326)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020206151.1)
• Pfam: Eukaryotic elongation factor 1 beta central acidic region (PF10587.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;