Protein coding transcript 9663

• Transcript: Ll_transcript_358123
• CDS coordinates: 26-439 (+)
• Peptide sequence: MKRRMCHILMAALIFSSLVCVLNKPLSPFDVNQQELFKPSNTVDQTTRIQDVPTPAFDSTQGDERIKKAKENGYKETLRGLSRLGSTPPRCEHKCGGCIPCDPIQIPTSNKHLLRLQYANYEPEGWKCKCANSYFNP*
• ORF Type: complete

Annotations of Ll_transcript_358123

• Blastp: EPIDERMAL PATTERNING FACTOR-like protein 3 from Arabidopsis with 43.21% of identity
• Blastx: EPIDERMAL PATTERNING FACTOR-like protein 3 from Arabidopsis with 43.21% of identity
• Eggnog: NA(ENOG410ZBMI)
• Kegg: Link to kegg annotations (AT3G13898)
• CantataDB: Link to cantataDB annotations (CNT0001168)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416839.1)
• Pfam: Epidermal patterning factor proteins (PF17181.3)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;