Protein coding transcript 96679

• Transcript: Ll_transcript_388941
• CDS coordinates: 675-1004 (+)
• Peptide sequence: MKGRTKVVLRHLPPSLSESSLFQQIDAVFSDRYHWFSFRPAKFSHKHTSYSRAYIDFKTPEDVIDFAHFFNGHLFVNEKGISLTSSSSSFLFQLSFLLPLPRNPVQSPC*
• ORF Type: complete

Annotations of Ll_transcript_388941

• Blastp: Regulator of nonsense transcripts UPF3 from Arabidopsis with 32.16% of identity
• Blastx: Regulator of nonsense transcripts UPF3 from Arabidopsis with 54.68% of identity
• Eggnog: UPF3 regulator of nonsense transcripts homolog(ENOG41122XD)
• Kegg: Link to kegg annotations (AT1G33980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440409.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;