Transcript | Ll_transcript_388945 |
---|---|
CDS coordinates | 675-1004 (+) |
Peptide sequence | MKGRTKVVLRHLPPSLSESSLFQQIDAVFSDRYHWFSFRPAKFSHKHTSYSRAYIDFKTPEDVIDFAHFFNGHLFVNEKGISLTSSSSSFLFQLSFLLPLPRNPVQSPC* |
ORF Type | complete |
Blastp | Regulator of nonsense transcripts UPF3 from Arabidopsis with 32.16% of identity |
---|---|
Blastx | Regulator of nonsense transcripts UPF3 from Arabidopsis with 54.68% of identity |
Eggnog | UPF3 regulator of nonsense transcripts homolog(ENOG41122XD) |
Kegg | Link to kegg annotations (AT1G33980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440409.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer