Protein coding transcript 96687

• Transcript: Ll_transcript_388935
• CDS coordinates: 204-941 (+)
• Peptide sequence: MKGGAMDRTKVVLRHLPPSLPESALSQQIDAAFSGRYNWLSFRPAKFRSQKHVSYSRAYIQFKSPDDVLDFADFFNAHVFVNEKGAHFKVIVEYAPSQRVPIHRSKKDARDGTIYKDSEYLEFLEHLAKPVENLPSAEIQLEKRDAERSGAAKDIPIVTPLMDFVRQKRAAKGPRVFLHWINSSSFKQIYLPSLVILSLACLWMCLWAEKIKSLTNILHYYVLPLSAIGFLLTVVRIGCIVQIKF*
• ORF Type: complete

Annotations of Ll_transcript_388935

• Blastp: Regulator of nonsense transcripts UPF3 from Arabidopsis with 35.55% of identity
• Blastx: Regulator of nonsense transcripts UPF3 from Arabidopsis with 66.87% of identity
• Eggnog: UPF3 regulator of nonsense transcripts homolog(ENOG41122XD)
• Kegg: Link to kegg annotations (AT1G33980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418458.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;