Protein coding transcript 96695

• Transcript: Ll_transcript_386402
• CDS coordinates: 1708-2238 (+)
• Peptide sequence: MSGAITTGFLGSNFAPVLGGQLISPTLPERPGQPECKYFMSTGTCKYGSDCKYHHPKERINQSLMNPLGLPVRPGHAICSYYRLSGICKFGPTCKFDHPILAIPQSYGLTSSHAFSVPDTSLINGRKVLSTVQPPDTSISKLSNDKVHHSDTKATENSSEQADSTTLDSLAATSES*
• ORF Type: complete

Annotations of Ll_transcript_386402

• Blastp: Zinc finger CCCH domain-containing protein 63 from Oryza sativa with 43.97% of identity
• Blastx: Zinc finger CCCH domain-containing protein 3 from Arabidopsis with 55.78% of identity
• Eggnog: zinc finger CCCH domain-containing protein(ENOG410ZQFM)
• Kegg: Link to kegg annotations (4350492)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455851.1)
• Pfam: Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;