Transcript | Ll_transcript_386411 |
---|---|
CDS coordinates | 2434-2964 (+) |
Peptide sequence | MSGAITTGFLGSNFAPVLGGQLISPTLPERPGQPECKYFMSTGTCKYGSDCKYHHPKERINQSLMNPLGLPVRPGHAICSYYRLSGICKFGPTCKFDHPILAIPQSYGLTSSHAFSVPDTSLINGRKVLSTVQPPDTSISKLSNDKVHHSDTKATENSSEQADSTTLDSLAATSES* |
ORF Type | complete |
Blastp | Zinc finger CCCH domain-containing protein 63 from Oryza sativa with 43.97% of identity |
---|---|
Blastx | Zinc finger CCCH domain-containing protein 3 from Arabidopsis with 58.54% of identity |
Eggnog | zinc finger CCCH domain-containing protein(ENOG410ZQFM) |
Kegg | Link to kegg annotations (4350492) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455851.1) |
Pfam | Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer