Protein coding transcript 96702

• Transcript: Ll_transcript_386392
• CDS coordinates: 1264-2064 (+)
• Peptide sequence: MRTGSCKFGVACKFHHPQIGASLVTGSPTSTILPTSGLPYVGGISAWQLPRMSYLSGQGIQSYVPPFLSSPQGIIPAQNWNTYMGSMSSAMPTTFLGSNFVYDTMNLGESLLGGQVISPTLPERPDQPECRYFMSTGTCKYGSDCKYHHPKERIAQSLMNPLGLPVRPGHAICSYYRLYGICKFGPTCKFDHPVLAIPQNYGLTSPAFPVLDTSLISNPIGFSTVQPSETSPSNDKVQHSHTKATEDSSKQADTTTPDSFPTTSQS*
• ORF Type: complete

Annotations of Ll_transcript_386392

• Blastp: Zinc finger CCCH domain-containing protein 3 from Arabidopsis with 45.16% of identity
• Blastx: Zinc finger CCCH domain-containing protein 3 from Arabidopsis with 46.88% of identity
• Eggnog: zinc finger(COG5063)
• Kegg: Link to kegg annotations (AT1G04990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461679.1)
• Pfam: Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;