Protein coding transcript 96705

• Transcript: Ll_transcript_386415
• CDS coordinates: 2304-2834 (+)
• Peptide sequence: MSGAITTGFLGSNFAPVLGGQLISPTLPERPGQPECKYFMSTGTCKYGSDCKYHHPKERINQSLMNPLGLPVRPGHAICSYYRLSGICKFGPTCKFDHPILAIPQSYGLTSSHAFSVPDTSLINGRKVLSTVQPPDTSISKLSNDKVHHSDTKATENSSEQADSTTLDSLAATSES*
• ORF Type: complete

Annotations of Ll_transcript_386415

• Blastp: Zinc finger CCCH domain-containing protein 3 from Arabidopsis with 54.8% of identity
• Blastx: Zinc finger CCCH domain-containing protein 3 from Arabidopsis with 44.73% of identity
• Eggnog: zinc finger(COG5063)
• Kegg: Link to kegg annotations (AT1G04990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455851.1)
• Pfam: RNA-binding, Nab2-type zinc finger (PF14608.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;