Transcript | Ll_transcript_388338 |
---|---|
CDS coordinates | 915-1796 (+) |
Peptide sequence | MCNDNGISTVSGSSRKGRRLAKNIVDEVFLDLTREEDQPTRVNRVHTDAAATSSHSGGVNNKNSLENRDGLDARLRNQSGAMNIASDGIEQIIDSNNVSTNRNSTLLEDSLPMAQTSVCFSAENSTDSGQIDIVGALPTSKELSCVICFEEYSSTRGILPCGHRYCYTCIQSWVDLRTSMGKSSTCPLCKASFVMFKKVEDAATGDQKVYSQTIPSGNSTSDIFVRTVQELPDYGFESGACVICRGREPEDLLQSCDVCRCRRIHLYCLDPPLLPWTCNHCKDLRRLYHHHSY* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | BRCT domain-containing protein At4g02110 from Arabidopsis with 46.94% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428742.1) |
Pfam | Zinc finger, C3HC4 type (RING finger) (PF13920.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer