Transcript | Ll_transcript_388973 |
---|---|
CDS coordinates | 2-328 (+) |
Peptide sequence | EKEDEEYVKNSEEEEEDDDDVVGNGKGPGPVSDDSQMYPVQSIRRKRVRKGQVQYLVKWLGWPESANTWEPPENLANVPDIIEAFEQRYSLFLPCNIYSFLHDFAFQL* |
ORF Type | 5prime_partial |
Blastp | Chromo domain-containing protein LHP1 from Arabidopsis with 66.04% of identity |
---|---|
Blastx | Chromo domain-containing protein LHP1 from Arabidopsis with 36.22% of identity |
Eggnog | chromobox homolog(ENOG4111JKD) |
Kegg | Link to kegg annotations (AT5G17690) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019465358.1) |
Pfam | Chromo (CHRromatin Organisation MOdifier) domain (PF00385.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer