Protein coding transcript 96871

• Transcript: Ll_transcript_388884
• CDS coordinates: 175-891 (+)
• Peptide sequence: MLLLSLAGATTGVPVTFSGELGHSVTKCSRKPTKLLSCPCIKVLPLQHHDTINFNLKRRKNINSLSSFAFGKEADESFLEDVNEDTDEMYDELFDKYGEVVFSRKDRKPSSAEVDDDAESLSFAVEMAKVANEVKAADIQVLFVKPLVYWTRFFIIATAFSRPQIDAIGSRIRDLAEKKYGKIPTGDSKPNSWTLLDFGDVVIHIFLPPQRAFYNLEEFYANATLVDLPFENQSPFRG*
• ORF Type: complete

Annotations of Ll_transcript_388884

• Blastp: Protein Iojap, chloroplastic from Arabidopsis with 67.3% of identity
• Blastx: Protein Iojap, chloroplastic from Arabidopsis with 67.3% of identity
• Eggnog: Functions as a ribosomal silencing factor. Interacts with ribosomal protein L14 (rplN), blocking formation of intersubunit bridge B8. Prevents association of the 30S and 50S ribosomal subunits and the formation of functional ribosomes, thus repressing translation (By similarity)(COG0799)
• Kegg: Link to kegg annotations (AT3G12930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425515.1)
• Pfam: Ribosomal silencing factor during starvation (PF02410.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;