Protein coding transcript 96875

• Transcript: Ll_transcript_386663
• CDS coordinates: 88-618 (+)
• Peptide sequence: MVNWDGLRTKDTERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKIMKVILAKEELSPGIDLDAVASMTDGYSGSDLKNLCVTAAHRPIKEILEKEKKELAAALAEGRPAPSLCNSGDIRSLNMDDFKYAHQQVCASVSSESVNMTELLQWNELYGEGGSRVKKSLSYFM*
• ORF Type: complete

Annotations of Ll_transcript_386663

• Blastp: Spastin from Gallus with 36.6% of identity
• Blastx: ATPase family AAA domain-containing protein 1-A from Danio with 50% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (421481)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015956381.2)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;