Protein coding transcript 96878

• Transcript: Ll_transcript_386666
• CDS coordinates: 1-375 (+)
• Peptide sequence: IFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERVLVLAATNRPFDLDEAVIRRLPRRLMVKLPDSPNRAKILKVILAKEELSPDINLDAIASMTDGYSGSDLKVVDVLFPDTLYF
• ORF Type: internal

Annotations of Ll_transcript_386666

• Blastp: ATPase family AAA domain-containing protein 1-A from Danio with 51.33% of identity
• Blastx: ATPase family AAA domain-containing protein 1-A from Danio with 51.33% of identity
• Eggnog: Aaa atpase(COG0464)
• Kegg: Link to kegg annotations (368672)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015956381.2)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;