Protein coding transcript 96879

• Transcript: Ll_transcript_386668
• CDS coordinates: 1-372 (+)
• Peptide sequence: IFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERVLVLAATNRPFDLDEAVIRRLPRRLMVKLPDSPNRAKILKVILAKEELSPDINLDAIASMTDGYSGSDLKLLHTIQLKRY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_386668

• Blastp: ATPase family AAA domain-containing protein 1-A from Danio with 51.3% of identity
• Blastx: ATPase family AAA domain-containing protein 1-A from Danio with 51.3% of identity
• Eggnog: Aaa atpase(COG0464)
• Kegg: Link to kegg annotations (368672)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017436198.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;