Protein coding transcript 96909

• Transcript: Ll_transcript_387351
• CDS coordinates: 37-450 (+)
• Peptide sequence: MEPILQDRNEAAGISVRVANELGKGSAEAAKFSIVVTVLTSLTIGFLLFLFFLFYRGRLAYIFTSNKEVADAVGDLSPLLSISILLNSVQPVLSGVAIGAGWQSIVAYVNIGSYYIIGIPVGIVLGKVIDLQVKGIWI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_387351

• Blastp: Protein DETOXIFICATION 20 from Arabidopsis with 64.57% of identity
• Blastx: Protein DETOXIFICATION 22 from Arabidopsis with 66.14% of identity
• Eggnog: Mate efflux family protein(COG0534)
• Kegg: Link to kegg annotations (AT1G33100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457195.1)
• Pfam: MatE (PF01554.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;