| Transcript | Ll_transcript_387353 |
|---|---|
| CDS coordinates | 939-1244 (+) |
| Peptide sequence | MFALPTCQSTSDLLNYVMPCRVVARLYPHGNTKVNQRNGTNLARQERGCWNQETIFIPYTNQRTFVEINLQLHTHKYYSTVFSSYTEPTFLYVCYEKLSLS* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Protein DETOXIFICATION 22 from Arabidopsis with 61.93% of identity |
| Eggnog | Mate efflux family protein(COG0534) |
| Kegg | Link to kegg annotations (AT1G33090) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019457195.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer