Transcript | Ll_transcript_388201 |
---|---|
CDS coordinates | 3-341 (+) |
Peptide sequence | ELPAVAAELPAVAAELPAVAAELPAVAAKVPAVAAVSAVVTPVTEGKKKRGRPRKYGPDGKVAAVARALSPMPISASIPLTGQLSAWKRGIGKPVEYAGQGRGKYCYLILEF* |
ORF Type | 5prime_partial |
Blastp | AT-hook motif nuclear-localized protein 3 from Arabidopsis with 54.72% of identity |
---|---|
Blastx | - |
Eggnog | Domain of unknown function (DUF296)(ENOG41114DS) |
Kegg | Link to kegg annotations (AT4G25320) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451022.1) |
Pfam | AT hook motif (PF02178.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer