Protein coding transcript 96946

• Transcript: Ll_transcript_388193
• CDS coordinates: 1-363 (+)
• Peptide sequence: VESIKKSTYKYEVESPGQGGGIAYSVGANFTAHVLTVNAGEDVTMKIMSFAQQGSSAICILSANGSISNVTLRQPTSSGGTLTYEFSCVSLIYRDGLRFFPCLVPLCQLIMELREADLVG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_388193

• Blastp: AT-hook motif nuclear-localized protein 3 from Arabidopsis with 76% of identity
• Blastx: AT-hook motif nuclear-localized protein 3 from Arabidopsis with 76% of identity
• Eggnog: Domain of unknown function (DUF296)(ENOG41114DS)
• Kegg: Link to kegg annotations (AT4G25320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427844.1)
• Pfam: Domain of unknown function (DUF296) (PF03479.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;