Transcript | Ll_transcript_388743 |
---|---|
CDS coordinates | 619-1623 (+) |
Peptide sequence | MMGGSSIDDDWLLASSTKTVVLVGRTGNGKSATGNSILGKKAFSSRLSSSGVTSTCELQKTVLSDGQHVNVIDTPGLFDFSAGSDFVGKEIVKCIDLAKDGIHAVLVVFSVRTRFTQEEEAALRSLQTLFGDKIVNYMIVVFTGGDALEDDGETLDDYLGRECPEPLQEILALCDNRRVLFDNKTKDGKKKFEQVQQLLSLVDMVISQNGGRPYVDELFTELKEGAIKLSEQQKAADSLKGYSKGEIMEFRKQMQQTYDDQLKRITEMVESKLKEATTRLERQLAEEQTARLKAEEKAKLAQLKSDDEIRKLRQHLEMAHEELRKRGENRCAIL* |
ORF Type | complete |
Blastp | Immune-associated nucleotide-binding protein 9 from Arabidopsis with 61.77% of identity |
---|---|
Blastx | Immune-associated nucleotide-binding protein 9 from Arabidopsis with 61.77% of identity |
Eggnog | gTPase, IMAP family member(ENOG4111GYZ) |
Kegg | Link to kegg annotations (AT1G33970) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461220.1) |
Pfam | AIG1 family (PF04548.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer