Protein coding transcript 971

• Transcript: Ll_transcript_348225
• CDS coordinates: 2-355 (+)
• Peptide sequence: SQKVGYMYWPDASESADAQFQKPFSEETARNIDGEVRRIVDEAYKQCRDLLEEKHKEVGIVAEELLRKEMLTRDDMVRLLGPRPFDDQGEFHKYFGGAGQAPLGGGSTAAPSPGGIGD
• ORF Type: internal

Annotations of Ll_transcript_348225

• Blastp: Mitochondrial respiratory chain complexes assembly protein AFG3 from Saccharomyces with 50% of identity
• Blastx: Mitochondrial respiratory chain complexes assembly protein AFG3 from Saccharomyces with 50% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YER017C)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003539662.1)
• Pfam: Peptidase family M41 (PF01434.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;