Protein coding transcript 97118

• Transcript: Ll_transcript_387531
• CDS coordinates: 1008-1346 (+)
• Peptide sequence: MPGMTAYAGFFEIGSPKKGEKVFVSAASGAVGQLVGQFAKLTGCYVVGSAGSKEKVDLLKNKLGFDEAFNYKDEPDLNAALKRYCPEGIDIYFENVGGKTLDAVLLNLKIHAR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_387531

• Blastp: 2-alkenal reductase (NADP(+)-dependent) from Nicotiana with 83.19% of identity
• Blastx: 2-alkenal reductase (NADP(+)-dependent) from Nicotiana with 80.33% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (BAA89423)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437238.1)
• Pfam: Zinc-binding dehydrogenase (PF00107.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;