Protein coding transcript 97176

• Transcript: Ll_transcript_386354
• CDS coordinates: 98-694 (+)
• Peptide sequence: MLSKNHHDTEKAAPPDPSDGVVPEDRCPIEEVALVVPETDDPSLPVMTFRAWFLGIASCIILIFLNTFFTFRTQPLAISAILMQIVVLPIGRFMASTLPTKEYSVYSYRFTLNPGPFNMKEHVIITIFANCGVSYGGGDAYSIGAITVMKAYYKQTLTFLCALFIVLTTQVEFRFFIFFPFNFASFYCYIFPLFVTYN*
• ORF Type: complete

Annotations of Ll_transcript_386354

• Blastp: Oligopeptide transporter 3 from Arabidopsis with 75% of identity
• Blastx: Oligopeptide transporter 3 from Arabidopsis with 75% of identity
• Eggnog: oligo-peptide transporter(ENOG410XNZC)
• Kegg: Link to kegg annotations (AT4G16370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434917.1)
• Pfam: OPT oligopeptide transporter protein (PF03169.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;