Protein coding transcript 97277

• Transcript: Ll_transcript_386830
• CDS coordinates: 1-483 (+)
• Peptide sequence: GSCFNVYGVAQHPKTKNLAVLIIIACRFEVLSSGYLRYPLHCCPPSPFTAVSWEDLWRETFPVGTEEFTDKLIQEEELSEDQKDAFKDFVKEKVREAKKANREVLLFLALQIMFHCFLHSNLFHIQVGKGSWKKSHCRNERAFENMRFYKVVPSAQSRCT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_386830

• Blastp: Protein HEAT INTOLERANT 4 from Arabidopsis with 35.96% of identity
• Blastx: Protein HEAT INTOLERANT 4 from Arabidopsis with 35.96% of identity
• Eggnog: atp gtp binding protein(ENOG4111F6X)
• Kegg: Link to kegg annotations (AT5G10010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020215518.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;