Transcript | Ll_transcript_386839 |
---|---|
CDS coordinates | 276-914 (+) |
Peptide sequence | MRKGTKRKTNQEKVSKPDQPPRPKRAKPSKPESEPEYFEDQRNLEDLWKETFPVGTEWDQLDTVYQFKWDFSNLENAFEEDGVLHGKKVYLFGCTEPQLVFFKGESKIVCIPVVVAVVSPFPPSDKIGINSVQRESEEIIPMKQMKMDWVPYIPLEGRDSQVDRLKSHKIFILRCTQRRYTFFFHFPSQFCITCACFRTCWYIRSSHLRDLL* |
ORF Type | complete |
Blastp | Protein HEAT INTOLERANT 4 from Arabidopsis with 67.95% of identity |
---|---|
Blastx | Protein HEAT INTOLERANT 4 from Arabidopsis with 70.55% of identity |
Eggnog | atp gtp binding protein(ENOG4111F6X) |
Kegg | Link to kegg annotations (AT5G10010) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462436.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer