Protein coding transcript 97293

• Transcript: Ll_transcript_386828
• CDS coordinates: 276-848 (+)
• Peptide sequence: MRKGTKRKTNQEKVSKPDQPPRPKRAKPSKPESEPEYFEDQRNLEDLWKETFPVGTEWDQLDTVYQFKWDFSNLENAFEEDGVLHGKKVYLFGCTEPQLVFFKGESKIVCIPVVVAVVSPFPPSDKIGINSVQRESEEIIPMKQMKMDWVPYIPLEDRDSQVDRLKSHQIFILRCTQRRNRVGIKRDSYL*
• ORF Type: complete

Annotations of Ll_transcript_386828

• Blastp: Protein HEAT INTOLERANT 4 from Arabidopsis with 68.59% of identity
• Blastx: Protein HEAT INTOLERANT 4 from Arabidopsis with 66.25% of identity
• Eggnog: atp gtp binding protein(ENOG4111F6X)
• Kegg: Link to kegg annotations (AT5G10010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462436.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;