| Transcript | Ll_transcript_388268 |
|---|---|
| CDS coordinates | 273-722 (+) |
| Peptide sequence | MKGKTRLFTIGLVSSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAWLKMVPLQTIRSRVQFLKISALSLIFCVSVVFGNISLRYLPVSFNQAIGATTPFFTAVFAYLITLKREAWLTYFTLLPVVTGVVIASGVN* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Probable sugar phosphate/phosphate translocator At3g11320 from Arabidopsis with 89.26% of identity |
| Eggnog | solute carrier family 35 member(ENOG410XP1S) |
| Kegg | Link to kegg annotations (AT3G11320) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019460876.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer