Protein coding transcript 97319

• Transcript: Ll_transcript_388271
• CDS coordinates: 227-715 (+)
• Peptide sequence: MKGKSRLFTIGLVSAWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAWLKMVPLQTIRSRVQFFKISALSLIFCVSVVFGNISLRYLPVSFNQAIGATTPFFTAVFAYLITFKREAWLTYFTLVPVVTGVVIASGVTIMNLAFYYSAVCF*
• ORF Type: complete

Annotations of Ll_transcript_388271

• Blastp: -
• Blastx: Probable sugar phosphate/phosphate translocator At3g11320 from Arabidopsis with 90.48% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: Link to kegg annotations (AT3G11320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455842.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;