Protein coding transcript 97322

• Transcript: Ll_transcript_388279
• CDS coordinates: 1571-1930 (+)
• Peptide sequence: MNLLLYMAPMAVVFLLPATLIMEENVVGITLALARDDMKIVWYLLFNSTLAYFVNLTNFLVTKHTSALTLQVLGNAKGAVAVVVSILIFRNPVSVTGMMGYALTVLGVILYSEAKKRSK*
• ORF Type: complete

Annotations of Ll_transcript_388279

• Blastp: Probable sugar phosphate/phosphate translocator At3g11320 from Arabidopsis with 92.44% of identity
• Blastx: Probable sugar phosphate/phosphate translocator At3g11320 from Arabidopsis with 89.26% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: Link to kegg annotations (AT3G11320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460876.1)
• Pfam: Triose-phosphate Transporter family (PF03151.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;