Protein coding transcript 97337

• Transcript: Ll_transcript_386977
• CDS coordinates: 1126-1728 (+)
• Peptide sequence: MTVMFVTTFLMALVIIFVWQKSVLVATVFLLLFWLIEGAYLSAAFIKVHQGGWVPLVLSFFFMVIMYVWHYGTRRKYNFDLRNKVSLKWLLGLGPSLGIVRVPGIGLIYSELTTGVPAIFSHFVTNLPAFHKVMIFVCVKSVPVPHVRPEERFLIGRVCPRAYRMYRCIIRYGYKDIQRDDGEFENQLIQSLAEFIQMEAV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_386977

• Blastp: Potassium transporter 4 from Arabidopsis with 81% of identity
• Blastx: Potassium transporter 4 from Arabidopsis with 80.88% of identity
• Eggnog: Transport of potassium into the cell (By similarity)(COG3158)
• Kegg: Link to kegg annotations (AT3G02050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442904.1)
• Pfam: K+ potassium transporter (PF02705.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;