Transcript | Ll_transcript_388167 |
---|---|
CDS coordinates | 1616-2569 (+) |
Peptide sequence | MPSCTRKGSGVPGYDWTSSHVHLYRLHRGITPAMIQDICFSQFSQWIAIVSSKGTCHLFVLSPFGGDTGFKIINSQGEEPSLLPVFPLPWWFMSSSTSYEHPSPPPAPSVLSVVSRIKYSSFGWLNTVHSSTSNVTGKVFVPSGAIAAVFHNSLSHSKQLGNSKVKPLEHLMVYTPSGHVVQHQLLPSVGPEPSECGLRTQSASNLHMQEDEFRVKVEPIQWWDVCRRSEWPEKWDPCGNTVDRQDGIVQEKMCSADGYGLDFWDISRGVGEKVVKHSTGKPQDRFHGYLSNAEVQVNFGRLQIWQKPKACIVLTAK* |
ORF Type | complete |
Blastp | Autophagy-related protein 18g from Arabidopsis with 53.85% of identity |
---|---|
Blastx | Autophagy-related protein 18g from Arabidopsis with 51.6% of identity |
Eggnog | Breast carcinoma amplified sequence(ENOG410XSW7) |
Kegg | Link to kegg annotations (AT1G03380) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441802.1) |
Pfam | Breast carcinoma amplified sequence 3 (PF12490.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer